PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016485734.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 383aa    MW: 41758.9 Da    PI: 5.4936
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016485734.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-165599147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT+eE++++v+a k++G   W+ I +++g ++t+ q++s+ qk+
   XP_016485734.1 55 REKWTEEEHQRFVEALKLYGRA-WRQIEEHVG-TKTAIQIRSHAQKF 99
                     789*****************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.49E-1649103IPR009057Homeodomain-like
PROSITE profilePS5129421.97150104IPR017930Myb domain
TIGRFAMsTIGR015577.4E-1753102IPR006447Myb domain, plants
SMARTSM007171.0E-1254102IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-95495IPR009057Homeodomain-like
PfamPF002491.9E-135598IPR001005SANT/Myb domain
CDDcd001677.17E-1057100No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MVAEALNQDE GARRGGSSMI SSKLETVATQ GKALTCLANE ITLKVRKPYT ITKQREKWTE  60
EEHQRFVEAL KLYGRAWRQI EEHVGTKTAI QIRSHAQKFF AKVARDSGTD GDESLNAIDI  120
PPPRPKKKPL HPYPRKMDDS PITTKSVSGQ PERSSSPNAS GRDSCSPDSV LSEIGSDASE  180
YPVAEQQSSR FSPRSCTTDA HTANIISGEN DDESMTSKSN IVKEIPVASK PVAASSSPIF  240
NSGMECDLVP RETSCPGEKL AVEAPLASIK LFGQTVLVPD ATKLALQSPG SCNSFPFKTT  300
ESEIVTNNGD VIHGFQANSQ FILPVVPGNM IPPACWLLQD MLENNPEGVA AFPTTLPWWS  360
WYQDLVYRYI SSCSQTTAET APP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1518041e-100AC151804.1 Solanum demissum chromosome 5 clone PGEC475B22, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016485734.10.0PREDICTED: protein REVEILLE 1-like isoform X1
TrEMBLM1CEP80.0M1CEP8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000658500.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74472127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.13e-38MYB_related family protein